PDB entry 1vju

View 1vju on RCSB PDB site
Description: Coproporphyrinogen III oxidase from Leishmania major
Class: oxidoreductase
Keywords: structural genomics, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, OXIDOREDUCTASE
Deposited on 2004-03-29, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coproporphyrinogen III oxidase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjua1, d1vjua2
  • Chain 'B':
    Compound: Coproporphyrinogen III oxidase
    Species: Leishmania major [TaxId:5664]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjub1, d1vjub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjuA (A:)
    mahhhhhhmslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvd
    gaviekggvnfshvygkglpmssterhpdiagcnfeamgvslvihpknphvptshanvrl
    fvaeregkepvwwfgggfdltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyf
    fipyrneargigglffddlnewpfekcfefvqavgkgymdayipivnrrkntpyteqqve
    fqefrrgryaefnlvidrgtkfglqsggrtesilislpprarwgynwqpepgtpearlte
    yfltkrqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjuA (A:)
    hmslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvdgaviekg
    gvnfshvygkgiagcnfeamgvslvihpknphvptshanvrlfvaeregkepvwwfgggf
    dltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyffipyrneargigglffdd
    lnewpfekcfefvqavgkgymdayipivnrrkntpyteqqvefqefrrgryaefnlvidr
    gtkfglqsggrtesilislpprarwgynwqpepgtpearlteyfltkrqwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vjuB (B:)
    mahhhhhhmslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvd
    gaviekggvnfshvygkglpmssterhpdiagcnfeamgvslvihpknphvptshanvrl
    fvaeregkepvwwfgggfdltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyf
    fipyrneargigglffddlnewpfekcfefvqavgkgymdayipivnrrkntpyteqqve
    fqefrrgryaefnlvidrgtkfglqsggrtesilislpprarwgynwqpepgtpearlte
    yfltkrqwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjuB (B:)
    hhhmslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvdgavie
    kggvnfshvygkgldiagcnfeamgvslvihpknphvptshanvrlfvaeregkepvwwf
    gggfdltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyffipyrneargiggl
    ffddlnewpfekcfefvqavgkgymdayipivnrrkntpyteqqvefqefrrgryaefnl
    vidrgtkfglqsggrtesilislpprarwgynwqpepgtpearlteyfltkrqwv