PDB entry 1vjs

View 1vjs on RCSB PDB site
Description: structure of alpha-amylase precursor
Class: hydrolase
Keywords: hydrolase, glycosidase, carbohydrate metabolism
Deposited on 1996-10-02, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Bacillus licheniformis [TaxId:1402]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vjsa1, d1vjsa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjsA (A:)
    anlngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygayd
    lydlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavev
    dpadrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgk
    awdwevsnengnydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsf
    lrdwvnhvrektgkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgg
    gydmrkllnstvvskhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypq
    vfygdmygtkgdsqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssva
    nsglaalitdgpggakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiy
    vqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjsA (A:)
    lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
    dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
    adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgkay
    dylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflrdwvnhvrektg
    kemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggydmrkllnstvv
    skhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvfygdmygtkgds
    qreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssvansglaalitdgpg
    gakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiyvq