PDB entry 1vjs

View 1vjs on RCSB PDB site
Description:
Deposited on 1996-10-02, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1vjs_1, d1vjs_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1vjs_ (-)
    lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
    dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
    adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgkaw
    dwevsnengnydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflr
    dwvnhvrektgkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggy
    dmrkllnstvvskhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvf
    ygdmygtkgdsqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssvans
    glaalitdgpggakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiyvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjs_ (-)
    lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
    dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
    adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgkay
    dylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflrdwvnhvrektg
    kemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggydmrkllnstvv
    skhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvfygdmygtkgds
    qreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssvansglaalitdgpg
    gakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiyvq