PDB entry 1vjr

View 1vjr on RCSB PDB site
Description: Crystal structure of 4-nitrophenylphosphatase (TM1742) from Thermotoga maritima at 2.40 A resolution
Class: hydrolase
Keywords: TM1742, 4-nitrophenylphosphatase, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2004-03-22, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.165
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-nitrophenylphosphatase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1742
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X264 (12-270)
      • leader sequence (10-11)
      • see remark 999 (12)
      • modified residue (23)
      • modified residue (72)
      • modified residue (92)
      • modified residue (177)
      • modified residue (214)
      • modified residue (216)
    Domains in SCOPe 2.07: d1vjra1, d1vjra2
  • Heterogens: NI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjrA (A:)
    mgsdkihhhhhhvldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnss
    lgaqdyvrklrnmgvdvpddavvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghv
    ideenpdfvvlgfdktltyerlkkacillrkgkfyiathpdincpskegpvpdagsimaa
    ieastgrkpdliagkpnplvvdvisekfgvpkermamvgdrlytdvklgknagivsilvl
    tgettpedleraetkpdfvfknlgelakavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjrA (A:)
    hhvldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnsslgaqdyvrkl
    rnmgvdvpddavvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghvideenpdfvv
    lgfdktltyerlkkacillrkgkfyiathpdincpskegpvpdagsimaaieastgrkpd
    liagkpnplvvdvisekfgvpkermamvgdrlytdvklgknagivsilvltgettpedle
    raetkpdfvfknlgelakavq