PDB entry 1vjq

View 1vjq on RCSB PDB site
Description: Designed protein based on backbone conformation of procarboxypeptidase-A (1AYE) with sidechains chosen for maximal predicted stability.
Class: structural genomics, de novo protein
Keywords: STRUCTURAL GENOMICS, ENGINEERED PROTEIN, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, DE NOVO PROTEIN
Deposited on 2004-03-19, released 2004-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: designed protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1VJQ (0-End)
    Domains in SCOPe 2.08: d1vjqa_
  • Chain 'B':
    Compound: designed protein
    Database cross-references and differences (RAF-indexed):
    • PDB 1VJQ (0-End)
    Domains in SCOPe 2.08: d1vjqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vjqA (A:)
ktifvivptneeqvaflealakqdelnfdwqnpptepgqpvvilipsdmvewflemlkak
gipftvyveeggsenkyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >1vjqA (A:)
ktifvivptneeqvaflealakqdelnfdwqnpptepgqpvvilipsdmvewflemlkak
gipftvyveeggs

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1vjqB (B:)
ktifvivptneeqvaflealakqdelnfdwqnpptepgqpvvilipsdmvewflemlkak
gipftvyveeggsenkyfq

    Sequence, based on observed residues (ATOM records): (download) 
    >1vjqB (B:)
ktifvivptneeqvaflealakqdelnfdwqnpptepgqpvvilipsdmvewflemlkak
gipftvyveeggs