PDB entry 1vjp

View 1vjp on RCSB PDB site
Description: Crystal structure of MYO-inositol-1-phosphate synthase-related protein (TM1419) from Thermotoga maritima at 1.70 A resolution
Class: isomerase
Keywords: TM1419, MYO-INOSITOL-1-PHOSPHATE SYNTHASE-RELATED PROTEIN, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2004-03-17, released 2004-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-03-25, with a file datestamp of 2008-03-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.177
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myo-inositol-1-phosphate synthase-related protein
    Species: Thermotoga maritima
    Gene: TM1419
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D6 (12-End)
      • leader sequence (11)
    Domains in SCOPe 2.06: d1vjpa3, d1vjpa4, d1vjpa5
  • Heterogens: CL, MG, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjpA (A:)
    mgsdkihhhhhhmvkvlilgqgyvastfvagleklrkgeiepygvplarelpigfediki
    vgsydvdrakigkklsevvkqywndvdsltsdpeirkgvhlgsvrnlpieaegledsmtl
    keavdtlvkewteldpdvivntctteafvpfgnkedllkaienndkerltatqvyayaaa
    lyankrggaafvnviptfiandpafvelakennlvvfgddgatgatpftadvlshlaqrn
    ryvkdvaqfniggnmdflaltddgknkskeftkssivkdilgydaphyikptgyleplgd
    kkfiaihieyvsfngatdelmingrindspalggllvdlvrlgkialdrkefgtvypvna
    fymknpgpaeeknipriiayekmriwaglkpkwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjpA (A:)
    hmvkvlilgqgyvastfvagleklrkgeiepygvplarelpigfedikivgsydvdraki
    gkklsevvkqywndvdsltsdpeirkgvhlgsvrnlpieaegledsmtlkeavdtlvkew
    teldpdvivntctteafvpfgnkedllkaienndkerltatqvyayaaalyankrggaaf
    vnviptfiandpafvelakennlvvfgddgatgatpftadvlshlaqrnryvkdvaqfni
    ggnmdflaltddgknkskeftkssivkdilgydaphyikptgyleplgdkkfiaihieyv
    sfngatdelmingrindspalggllvdlvrlgkialdrkefgtvypvnafymknpgpaee
    knipriiayekmriwaglkpkw