PDB entry 1vjo

View 1vjo on RCSB PDB site
Description: Crystal structure of Alanine--glyoxylate aminotransferase (ALR1004) from Nostoc sp. at 1.70 A resolution
Class: transferase
Keywords: 17130350, ALR1004, ALANINE--GLYOXYLATE AMINOTRANSFERASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, TRANSFERASE
Deposited on 2004-03-16, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.154
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alanine--glyoxylate aminotransferase
    Species: Nostoc sp. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YY48 (Start-392)
      • modified residue (52)
      • modified residue (68)
      • modified residue (97)
      • modified residue (126)
      • modified residue (233)
      • modified residue (255)
      • modified residue (371)
    Domains in SCOPe 2.08: d1vjoa_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjoA (A:)
    mgsdkihhhhhhmaqiisindnqrlqleplevpsrlllgpgpsnahpsvlqamnvspvgh
    ldpaflalmdeiqsllryvwqtenpltiavsgtgtaameatianavepgdvvligvagyf
    gnrlvdmagrygadvrtiskpwgevfsleelrtalethrpailalvhaetstgarqpleg
    vgelcrefgtlllvdtvtslggvpifldawgvdlayscsqkglgcspgaspftmssraie
    klqrrrtkvanwyldmnllgkywgservyhhtapinlyyalrealrliaqeglancwqrh
    qknveylwerlediglslhvekeyrlptlttvcipdgvdgkavarrllnehnievggglg
    elagkvwrvglmgfnsrkesvdqlipaleqvlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjoA (A:)
    isindnqrlqleplevpsrlllgpgpsnahpsvlqamnvspvghldpaflalmdeiqsll
    ryvwqtenpltiavsgtgtaameatianavepgdvvligvagyfgnrlvdmagrygadvr
    tiskpwgevfsleelrtalethrpailalvhaetstgarqplegvgelcrefgtlllvdt
    vtslggvpifldawgvdlayscsqkglgcspgaspftmssraieklqrrrtkvanwyldm
    nllgkywgservyhhtapinlyyalrealrliaqeglancwqrhqknveylwerledigl
    slhvekeyrlptlttvcipdgvdgkavarrllnehnievggglgelagkvwrvglmgfns
    rkesvdqlipaleqvlr