PDB entry 1vjn

View 1vjn on RCSB PDB site
Description: Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 A resolution
Class: hydrolase
Keywords: Metallo-hydrolase/oxidoreductase fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, hydrolase
Deposited on 2004-03-11, released 2004-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WY50 (12-219)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (171)
      • modified residue (216)
    Domains in SCOPe 2.07: d1vjna1, d1vjna2
  • Chain 'B':
    Compound: Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0207
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WY50 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (171)
      • modified residue (216)
    Domains in SCOPe 2.07: d1vjnb1, d1vjnb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjnA (A:)
    mgsdkihhhhhhmkitwfghacfalemegktivtdpfdesvgypipnvtadvvteshqhf
    dhnahhlvkgnfrvidrpgaytvngvkikgvetfhdpshgrergknivfvfegegikvch
    lgdlghvltpaqveeigeidvllvpvggtytigpkeakevadllnakviipmhyktkylk
    fnllpvddflklfdsyervgnilelfekpkerkvvvmevq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjnA (A:)
    hmkitwfghacfalemegktivtdpfdpipnvtadvvteshqhnahhlvkgnfrvidrpg
    aytvngvkikgvetfhdgknivfvfegegikvchlgdlghvltpaqveeigeidvllvpv
    ggtytigpkeakevadllnakviipmhyktkylkfnllpvddflklfdsyervgnilelf
    ekpkerkvvvmevq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vjnB (B:)
    mgsdkihhhhhhmkitwfghacfalemegktivtdpfdesvgypipnvtadvvteshqhf
    dhnahhlvkgnfrvidrpgaytvngvkikgvetfhdpshgrergknivfvfegegikvch
    lgdlghvltpaqveeigeidvllvpvggtytigpkeakevadllnakviipmhyktkylk
    fnllpvddflklfdsyervgnilelfekpkerkvvvmevq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjnB (B:)
    hmkitwfghacfalemegktivtdpfypipnvtadvvteshqnahhlvkgnfrvidrpga
    ytvngvkikgvetfknivfvfegegikvchlgdlghvltpaqveeigeidvllvpvggty
    tigpkeakevadllnakviipmhyktkylkfnllpvddflklfdsyervgnilelfekpk
    erkvvvmev