PDB entry 1vjm

View 1vjm on RCSB PDB site
Description: Deformation of helix C in the low-temperature L-intermediate of bacteriorhodopsin
Class: transport protein
Keywords: Ion transport, Photoreceptor, Transmembrane, RETINAL protein, Hydrogen ion Transport, TRANSPORT PROTEIN
Deposited on 2004-03-12, released 2004-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.252
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriorhodopsin
    Species: Halobacterium sp. [TaxId:2243]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjma_
  • Heterogens: RET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjmA (A:)
    qaqitgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsm
    llgygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimig
    tglvgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvv
    lwsaypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeaeapepsa
    gdgaaatsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjmA (A:)
    tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
    gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
    galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
    ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifge