PDB entry 1vjk

View 1vjk on RCSB PDB site
Description: Putative molybdopterin converting factor, subunit 1 from Pyrococcus furiosus, Pfu-562899-001
Class: structural genomics, unknown function
Keywords: structural genomics, molybdopterin converting factor, subunit 1, Pfu-562899-001, Pyrococcus furiosus, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2004-03-10, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin converting factor, subunit 1
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3C7 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d1vjka1, d1vjka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjkA (A:)
    ahhhhhhgsvkvkvkyfarfrqlagvdeeeielpegarvrdlieeikkrhekfkeevfge
    gydedadvniavngryvswdeelkdgdvvgvfppvsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjkA (A:)
    svkvkvkyfarfrqlagvdeeeielpegarvrdlieeikkrhekfkeevfgegydedadv
    niavngryvswdeelkdgdvvgvfppvs