PDB entry 1vji

View 1vji on RCSB PDB site
Description: Gene Product of At1g76680 from Arabidopsis thaliana
Class: plant protein
Keywords: Structural genomics, Arabidopsis Thaliana, Center for Eukaryotic Structural Genomics, Protein Structure Initiative, CESG, PLANT PROTEIN
Deposited on 2004-02-24, released 2004-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 12-oxophytodienoate reductase (OPR1)
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g76680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjia_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjiA (A:)
    mengeakqsvplltpykmgrfnlshrvvlapltrqrsygnvpqphaaiyysqrttpggfl
    iteatgvsdtaqgyqdtpgiwtkehveawkpivdavhakggiffcqiwhvgrvsnsgfqp
    ngkapiscsdkplmpqirsngidealftpprrlgieeipgivndfrlaarnameagfdgv
    eihgangylidqfmkdtvndrtdeyggslqnrckfpleivdavakeigpdrvgirlspfa
    dymesgdtnpgalglymaeslnkygilychviearmktmgevhacphtlmpmrkafkgtf
    isaggftredgneavskgrtdlvaygrwflanpdlpkrfqvdaplnkydrptfytsdpvv
    gytdypflesta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjiA (A:)
    svplltpykmgrfnlshrvvlapltrqrsygnvpqphaaiyysqrttpggfliteatgvs
    dtaqgyqdtpgiwtkehveawkpivdavhakggiffcqiwhvgrvsnsgfqpngkapisc
    sdkplmpqirsngidealftpprrlgieeipgivndfrlaarnameagfdgveihgangy
    lidqfmkdtvndrtdeyggslqnrckfpleivdavakeigpdrvgirlspfadymesgdt
    npgalglymaeslnkygilychviearmhtlmpmrkafkgtfisaggftredgneavskg
    rtdlvaygrwflanpdlpkrfqvdaplnkydrptfytsdpvvgytdypfle