PDB entry 1vjh

View 1vjh on RCSB PDB site
Description: crystal structure of gene product of at1g24000 from arabidopsis thaliana
Deposited on 2004-02-20, released 2004-03-16
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vjha_
  • Chain 'B':
    Domains in SCOP 1.67: d1vjhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjhA (A:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjhA (A:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vjhB (B:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjhB (B:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf