PDB entry 1vjh

View 1vjh on RCSB PDB site
Description: Crystal structure of gene product of At1g24000 from Arabidopsis thaliana
Class: plant protein
Keywords: Structural genomics, Arabidopsis Thaliana, Center for Eukaryotic Structural Genomics, Protein Structure Initiative, CESG, PLANT PROTEIN
Deposited on 2004-02-20, released 2004-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bet v I allergen family
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g24000
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LR93 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d1vjha1, d1vjha2
  • Chain 'B':
    Compound: Bet v I allergen family
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g24000
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LR93 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d1vjhb1, d1vjhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjhA (A:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjhA (A:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vjhB (B:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf
    ke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjhB (B:)
    stlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiq
    kyfktlkgsiavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnf