PDB entry 1vjg

View 1vjg on RCSB PDB site
Description: Crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.01 A resolution
Class: hydrolase
Keywords: Putative lipase from the g-d-s-l family, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, hydrolase
Deposited on 2004-02-19, released 2004-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.175
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative lipase from the G-D-S-L family
    Species: Nostoc sp. [TaxId:103690]
    Gene: ALR1529
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YWS4
      • modified residue (133)
    Domains in SCOPe 2.07: d1vjga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjgA (A:)
    mgsdkihhhhhhmtkqsktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyy
    nlgirrdtssdiakrwlqevslrlhkeynslvvfsfglndttlengkprvsiaetikntr
    eiltqakklypvlmispapyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekp
    svwlheakandgvhpqaggytefarivenwdawlnwfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjgA (A:)
    sktqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrw
    lqevslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmis
    papyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpq
    aggytefarivenwdawlnwf