PDB entry 1vjf

View 1vjf on RCSB PDB site
Description: crystal structure of a putative DNA-binding protein (cc_0111) from caulobacter crescentus cb15 at 1.62 a resolution
Class: DNA binding protein
Keywords: DNA binding protein, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi
Deposited on 2004-02-11, released 2004-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.146
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein, putative
    Species: Caulobacter crescentus CB15 [TaxId:190650]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ABV9 (12-179)
      • modified residue (12)
      • modified residue (50)
      • modified residue (99-100)
      • modified residue (168)
      • modified residue (175)
    Domains in SCOPe 2.07: d1vjfa_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjfA (A:)
    mgsdkihhhhhhmktradlfaffdahgvdhktldhppvfrveegleikaampgghtknlf
    lkdakgqlwlisalgettidlkklhhvigsgrlsfgpqemmletlgvtpgsvtafglind
    tekrvrfvldkaladsdpvnfhplkndattavsqaglrrflaalgvepmivdfaamevvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjfA (A:)
    mktradlfaffdahgvdhktldhppvfrveegleikaampgghtknlflkdakgqlwlis
    algettidlkklhhvigsgrlsfgpqemmletlgvtpgsvtafglindtekrvrfvldka
    ladsdpvnfhplkndattavsqaglrrflaalgvepmivdfaamevvg