PDB entry 1vje

View 1vje on RCSB PDB site
Description: Crystal structure of a autoinducer-2 synthesis protein with bound selenomethionine
Class: Hydrolase
Keywords: structural genomics, Hydrolase
Deposited on 2004-02-03, released 2004-02-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.188
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: autoinducer-2 production protein luxs
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: LUXS, DR2387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RRU8
      • modified residue (81)
    Domains in SCOPe 2.05: d1vjea_
  • Chain 'B':
    Compound: autoinducer-2 production protein luxs
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: LUXS, DR2387
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RRU8
      • modified residue (81)
    Domains in SCOPe 2.05: d1vjeb_
  • Heterogens: ZN, MSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjeA (A:)
    mpdmanvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtle
    hllagymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgv
    selecgnyrdhdlaaarqhardvldqglkvqetillergshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjeA (A:)
    esfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagym
    rdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecgn
    yrdhdlaaarqhardvldqglkvqetill
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vjeB (B:)
    mpdmanvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtle
    hllagymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgv
    selecgnyrdhdlaaarqhardvldqglkvqetillergshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjeB (B:)
    vesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllagy
    mrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselecg
    nyrdhdlaaarqhardvldqglkvqetill