PDB entry 1vjc

View 1vjc on RCSB PDB site
Description: Structure of pig muscle PGK complexed with MgATP
Class: transferase
Keywords: ATP, Mg, TRANSFERASE
Deposited on 2004-02-03, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjca_
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vjcA (A:)
    slsnkltldkldvkgkrvvmrvdfnvpmknnqitnnqrikaaipsikfcldngaksvvlm
    shlgrpdgipmpdkyslepvavelksllgkdvlflkdcvgpevekacadpaagsvillen
    lrfhveeegkgkdasgskvkadpakieafraslsklgdvyvndafgtahrahssmvgvnl
    pkkaggflmkkelnyfakalesperpflailggakvadkiqlinnmldkvnemiigggma
    ftflkvlnnmeigtslfdeegskivkdlmskaekngvkitlpvdfvtadkfdenaktgqa
    tvasgipagwmgldcgpesskkyseavarakqivwngpvgvfeweafaqgtkalmdevvk
    atsrgcitiigggdtatccakwntedkvshvstgggaslellegkvlpgvdalsnv