PDB entry 1vjb

View 1vjb on RCSB PDB site
Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with 4-hydroxytamoxifen
Class: transcription
Keywords: ligand-binding domain, ANTAGONIST COMPLEX, TRANSCRIPTION
Deposited on 2004-02-03, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.256
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen-related receptor gamma
    Species: Mus musculus [TaxId:10090]
    Gene: ESRRG, NR3B3, ERRG2, ERR3, KIAA0832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjba_
  • Chain 'B':
    Compound: Estrogen-related receptor gamma
    Species: Mus musculus [TaxId:10090]
    Gene: ESRRG, NR3B3, ERRG2, ERR3, KIAA0832
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjbb_
  • Heterogens: OHT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjbA (A:)
    mgsshhhhhhssglvprgshmpakkpynkivshllvaepekiyampdptvpdsdikaltt
    lcdladrelvviigwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvya
    ddyimdedqsklaglldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedvea
    vqklqdvlhealqdyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmh
    klflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjbA (A:)
    ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
    ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
    kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
    agkmlmtlpllrqtstkavqhfynikle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vjbB (B:)
    mgsshhhhhhssglvprgshmpakkpynkivshllvaepekiyampdptvpdsdikaltt
    lcdladrelvviigwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvya
    ddyimdedqsklaglldlnnailqlvkkyksmklekeefvtlkaialansdsmhiedvea
    vqklqdvlhealqdyeagqhmedprragkmlmtlpllrqtstkavqhfyniklegkvpmh
    klflemleakv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjbB (B:)
    pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
    sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
    vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
    ragkmlmtlpllrqtstkavqhfynikleg