PDB entry 1vja

View 1vja on RCSB PDB site
Description: Urokinase Plasminogen Activator B-Chain-JT463 Complex
Deposited on 2004-02-03, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Domains in SCOP 1.69: d1vjau_

PDB Chain Sequences:

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1vjaU (U:)
    lkfqcgqktlrprfkiiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisat
    hcfidypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirs
    kegrcaqpsrtiqtislpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishr
    ecqqphyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalk
    dkpgvytrvshflpwirshtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjaU (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtke