PDB entry 1vj7

View 1vj7 on RCSB PDB site
Description: Crystal structure of the bifunctional catalytic fragment of RelSeq, the RelA/SpoT homolog from Streptococcus equisimilis.
Deposited on 2004-02-03, released 2004-05-04
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.238
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj7A (A:)
    makeinltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagi
    ladlhldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveyksheeql
    aenhrkmlmamskdirvilvkladrlhnmrtlkhlrkdkqerisretmeiyaplahrlgi
    srikweledlafrylnetefykishmmnekrrerealvddivtkiksytteqglfgdvyg
    rpkhiysiyrkmrdkkkrfdqifdliaircvmetqsdvyamvgyihelwrpmpgrfkdyi
    aapkangyqsihttvygpkgpieiqirtkemhqvaeygvaahwaykkgvrgkvnqaeqkv
    gmnwikelvelqdasngdavdfvdslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj7A (A:)
    inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
    hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklghrkmlmamskdirvi
    lvkladrlhnmrtlkqerisretmeiyaplahrlgisrikweledlafrylnetefykis
    hmmnekrrerealvddivtkiksytteqglfgdvygrpkhiysiyrkmrdkkkrfdqifd
    liaircvmetqsdvyamvgyihelwrpmpgrfkdyiaapkangyqsihttvygpkgpiei
    qirtkemhqvaeygvaanwikelvel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vj7B (B:)
    makeinltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagi
    ladlhldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveyksheeql
    aenhrkmlmamskdirvilvkladrlhnmrtlkhlrkdkqerisretmeiyaplahrlgi
    srikweledlafrylnetefykishmmnekrrerealvddivtkiksytteqglfgdvyg
    rpkhiysiyrkmrdkkkrfdqifdliaircvmetqsdvyamvgyihelwrpmpgrfkdyi
    aapkangyqsihttvygpkgpieiqirtkemhqvaeygvaahwaykkgvrgkvnqaeqkv
    gmnwikelvelqdasngdavdfvdslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj7B (B:)
    inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
    hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveskdirvilvkla
    drlhnmrtlkhlrkdkqerisretmeiyaplahrlgisrikweledlafrylnetefyki
    shmmneklvddivtkiksytteqglfgdvygrpkhiysiyrkmrifdliaircvmetqsd
    vyamvgyihelwrpmpgrfkdyiaapkangyqsihttvygpkgpieiqirtkemhqvaey
    gvawikelve