PDB entry 1vj7

View 1vj7 on RCSB PDB site
Description: Crystal structure of the bifunctional catalytic fragment of RelSeq, the RelA/SpoT homolog from Streptococcus equisimilis.
Class: hydrolase, transferase
Keywords: HD domain, alpha beta 2-layer sandwich, helix bundle, manganese, GDP, ppG2':3'p, (P)PPGPP, PPGPP, rela, spot, stringent response, stringent factor, stringent effector, magic spot, rsh, HYDROLASE, TRANSFERASE
Deposited on 2004-02-03, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.238
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional RELA/SPOT
    Species: Streptococcus dysgalactiae [TaxId:119602]
    Gene: RELA, REL, SPOT, RSH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj7a1, d1vj7a2
  • Chain 'B':
    Compound: Bifunctional RELA/SPOT
    Species: Streptococcus dysgalactiae [TaxId:119602]
    Gene: RELA, REL, SPOT, RSH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj7b1, d1vj7b2
  • Heterogens: MN, GDP, GPX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj7A (A:)
    makeinltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagi
    ladlhldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveyksheeql
    aenhrkmlmamskdirvilvkladrlhnmrtlkhlrkdkqerisretmeiyaplahrlgi
    srikweledlafrylnetefykishmmnekrrerealvddivtkiksytteqglfgdvyg
    rpkhiysiyrkmrdkkkrfdqifdliaircvmetqsdvyamvgyihelwrpmpgrfkdyi
    aapkangyqsihttvygpkgpieiqirtkemhqvaeygvaahwaykkgvrgkvnqaeqkv
    gmnwikelvelqdasngdavdfvdslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj7A (A:)
    inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
    hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklghrkmlmamskdirvi
    lvkladrlhnmrtlkqerisretmeiyaplahrlgisrikweledlafrylnetefykis
    hmmnekrrerealvddivtkiksytteqglfgdvygrpkhiysiyrkmrdkkkrfdqifd
    liaircvmetqsdvyamvgyihelwrpmpgrfkdyiaapkangyqsihttvygpkgpiei
    qirtkemhqvaeygvaanwikelvel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vj7B (B:)
    makeinltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagi
    ladlhldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveyksheeql
    aenhrkmlmamskdirvilvkladrlhnmrtlkhlrkdkqerisretmeiyaplahrlgi
    srikweledlafrylnetefykishmmnekrrerealvddivtkiksytteqglfgdvyg
    rpkhiysiyrkmrdkkkrfdqifdliaircvmetqsdvyamvgyihelwrpmpgrfkdyi
    aapkangyqsihttvygpkgpieiqirtkemhqvaeygvaahwaykkgvrgkvnqaeqkv
    gmnwikelvelqdasngdavdfvdslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj7B (B:)
    inltgeevvalaakymnetdaafvkkaldyataahfyqvrksgepyivhpiqvagiladl
    hldavtvacgflhdvvedtditldniefdfgkdvrdivdgvtklgkveskdirvilvkla
    drlhnmrtlkhlrkdkqerisretmeiyaplahrlgisrikweledlafrylnetefyki
    shmmneklvddivtkiksytteqglfgdvygrpkhiysiyrkmrifdliaircvmetqsd
    vyamvgyihelwrpmpgrfkdyiaapkangyqsihttvygpkgpieiqirtkemhqvaey
    gvawikelve