PDB entry 1vj5

View 1vj5 on RCSB PDB site
Description: human soluble epoxide hydrolase- n-cyclohexyl-n'-(4-iodophenyl)urea complex
Deposited on 2004-02-03, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj5A (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj5A (A:)
    tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
    qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
    ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
    flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshgy
    vtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygessa
    ppeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslntp
    fipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmhk
    vceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwackslg
    rkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilikw
    ldsdarn