PDB entry 1vj3

View 1vj3 on RCSB PDB site
Description: structural studies on bio-active compounds. crystal structure and molecular modeling studies on the pneumocystis carinii dihydrofolate reductase cofactor complex with tab, a highly selective antifolate.
Class: oxidoreductase
Keywords: tab, nadph, molecular modeling, oxidoreductase
Deposited on 2004-01-13, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Pneumocystis carinii [TaxId:4754]
    Gene: C-DNA P.CARINII DHFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj3a_
  • Heterogens: NDP, TAB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vj3A (A:)
    nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
    wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
    viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
    gtkvphgkinedgfdyefemwtrdl