PDB entry 1vj2

View 1vj2 on RCSB PDB site
Description: Crystal structure of a novel family of manganese-containing cupin (tm1459) from thermotoga maritima at 1.65 A resolution
Class: metal binding protein
Keywords: Novel manganese-containing cupin, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, metal binding protein
Deposited on 2003-12-03, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novel manganese-containing cupin TM1459
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1459
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj2a_
  • Chain 'B':
    Compound: novel manganese-containing cupin TM1459
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1459
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vj2b_
  • Heterogens: MN, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj2A (A:)
    mgsdkihhhhhhmilkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepggl
    idrhshpweheifvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflcli
    pkegge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj2A (A:)
    milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
    fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vj2B (B:)
    mgsdkihhhhhhmilkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepggl
    idrhshpweheifvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflcli
    pkegge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj2B (B:)
    milkraydvtpqkistdkvrgvrkrvliglkdapnfvmrlftvepgglidrhshpwehei
    fvlkgkltvlkeqgeetveegfyifvepneihgfrndtdseveflclipkegge