PDB entry 1vj1

View 1vj1 on RCSB PDB site
Description: Crystal structure of putative NADPH-dependent oxidoreductase from Mus musculus at 2.10 A resolution
Class: unknown function
Keywords: PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2003-12-03, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative NADPH-dependent oxidoreductase
    Species: Mus musculus [TaxId:10090]
    Gene: ZADH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VDQ1 (12-362)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (63)
      • modified residue (67)
      • modified residue (146)
      • modified residue (169)
      • modified residue (255)
      • modified residue (336)
      • modified residue (343-344)
    Domains in SCOPe 2.07: d1vj1a1, d1vj1a2, d1vj1a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj1A (A:)
    mgsdkihhhhhhmiiqrvvlnsrpgkngnpvaenfrveefslldalnegqvqvrtlylsv
    dpymrckmnedtgtdylapwqlaqvadgggigiveeskhqklakgdfvtsfywpwqtkai
    ldgnglekvdpqlvdghlsyflgaigmpgltsligvqekghisagsnqtmvvsgaagacg
    slagqighllgcsrvvgicgtqekclfltselgfdaavnyktgnvaeqlreacpggvdvy
    fdnvggdisntvisqmnenshiilcgqisqynkdvpyppplppaveairkernitrerft
    vlnykdkfepgilqlsqwfkegklkvketvakglenmgvafqsmmtggnvgkqivcised
    ssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj1A (A:)
    hhmiiqrvvlnsrpgkngnpvaenfrveefslldalnegqvqvrtlylsvdpymrckmne
    dtgtdylapwqlaqvadgggigiveeskhqklakgdfvtsfywpwqtkaildgnglekvd
    pqlvdghlsyflgaigmpgltsligvqekghisagsnqtmvvsgaagacgslagqighll
    gcsrvvgicgtqekclfltselgfdaavnyktgnvaeqlreacpggvdvyfdnvggdisn
    tvisqmnenshiilcppplppaveairkernitrerftvlnykdkfepgilqlsqwfkeg
    klkvketvakglenmgvafqsmmtggnvgkqivcisedssl