PDB entry 1vj0

View 1vj0 on RCSB PDB site
Description: crystal structure of alcohol dehydrogenase (tm0436) from thermotoga maritima at 2.00 a resolution
Deposited on 2003-12-02, released 2004-03-02
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vj0A (A:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0A (A:)
    mglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpi
    ilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvy
    ginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypes
    fagktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsve
    errkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyew
    lvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealk
    vilype
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vj0B (B:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0B (B:)
    lkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpiil
    ghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvygi
    nrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypesfa
    gktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsveer
    rkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyewlv
    lknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealkvi
    lype
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vj0C (C:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0C (C:)
    lkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpiil
    ghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvygi
    nrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypesfa
    gktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsveer
    rkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyewlv
    lknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealkvi
    lype
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vj0D (D:)
    mgsdkihhhhhhmmglkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvh
    mfrgedprvplpiilghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckv
    skepylcpnrkvyginrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsg
    atayhafdeypesfagktvviqgagplglfgvviarslgaenviviagspnrlklaeeig
    adltlnrretsveerrkaimdithgrgadfileatgdsrallegsellrrggfysvagva
    vpqdpvpfkvyewlvlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkean
    kalelmesrealkvilypeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vj0D (D:)
    glkahamvlekfnqplvykefeisdiprgsilveilsagvcgsdvhmfrgedprvplpii
    lghegagrvvevngekrdlngellkpgdlivwnrgitcgecywckvskepylcpnrkvyg
    inrgcseyphlrgcysshivldpetdvlkvsekddldvlamamcsgatayhafdeypesf
    agktvviqgagplglfgvviarslgaenviviagspnrlklaeeigadltlnrretsvee
    rrkaimdithgrgadfileatgdsrallegsellrrggfysvagvavpqdpvpfkvyewl
    vlknatfkgiwvsdtshfvktvsitsrnyqllsklithrlplkeankalelmesrealkv
    ilype