PDB entry 1viz

View 1viz on RCSB PDB site
Description: crystal structure of an hypothetical protein
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1viza_
  • Chain 'B':
    Domains in SCOP 1.67: d1vizb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vizA (A:)
    mslydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrf
    lvpcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegy
    cianpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavl
    etstlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkgeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vizA (A:)
    slydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggtednvlrmmskvrrflvpcv
    levsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycianp
    dckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavletstl
    fygggikdaetakqyaehadvivvgnavyedfdralktvaavkge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vizB (B:)
    mslydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggsdgvtednvlrmmskvrrf
    lvpcvlevsaieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegy
    cianpdckaaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavl
    etstlfygggikdaetakqyaehadvivvgnavyedfdralktvaavkgeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vizB (B:)
    lydvtewkhvfkldpnkdlpdeqleilcesgtdaviiggdnvlrmmskvrrflvpcvlev
    saieaivpgfdlyfipsvlnsknadwivgmhqkamkeygelmsmeeivaegycianpdck
    aaalteadadlnmddivayarvsellqlpifyleysgvlgdieavkktkavletstlfyg
    ggikdaetakqyaehadvivvgnavyedfdralktvaavk