PDB entry 1viw

View 1viw on RCSB PDB site
Description: tenebrio molitor alpha-amylase-inhibitor complex
Class: complex (glycosidase/inhibitor)
Keywords: COMPLEX (GLYCOSIDASE-INHIBITOR), HYDROLASE, LECTIN, INSECT ALPHA-AMYLASE, INHIBITORS, COMPLEX (GLYCOSIDASE-INHIBITOR) complex
Deposited on 1998-07-21, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Tenebrio molitor [TaxId:7067]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56634 (1-470)
      • conflict (72)
      • conflict (157)
      • conflict (199)
    Domains in SCOPe 2.07: d1viwa1, d1viwa2
  • Chain 'B':
    Compound: alpha-amylase-inhibitor
    Species: Phaseolus vulgaris [TaxId:3885]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1viwb_
  • Heterogens: CL, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1viwA (A:)
    ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
    qpvsyiintrsgnesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
    pavpygsgdfhspcevnnyqdadnvrncelvglrdlnagsdyvrgvlidymnhmidlgva
    gfrvdaakhmspgdlsvifdglknlntdygfadgarpfiyqevidlggeaiskneytgfg
    cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
    npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
    ehrwrqvygmvgfrnavegtqvenwwsnddnqiafsrgsqgfvaftnggdlnqnlntglp
    agtycdvisgelsggsctgksvtvgdngsadislgsaeddgvlaihvnakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1viwB (B:)
    atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
    sfdtnftmnirthrqansavgldfvlvpvqpeskgdtvtvefdtflsrisidvnnndiks
    vpwdvhdydgqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfs
    atsgayqwsyethdvlswsfsskfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viwB (B:)
    atetsfiidafnktnlilqgdatvssngnlqlsynsydsmsrafysapiqirdsttgnva
    sfdtnftmnirthrqsavgldfvlvpvqdtvtvefdtflsrisidvnnndiksvpwdvhd
    ydgqnaevritynsstkvfsvslsnpstgksnnvsttvelekevydwvsvgfsatsgayq
    wsyethdvlswsfsskfi