PDB entry 1viu

View 1viu on RCSB PDB site
Description: Crystal structure of putative ADP ribose pyrophosphatase
Class: hydrolase
Keywords: structural genomics, Hydrolase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribose pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YFFH, B2467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37128 (Start-192)
      • modified residue (121)
      • modified residue (167)
      • modified residue (191)
    Domains in SCOPe 2.07: d1viua_
  • Chain 'B':
    Compound: ADP-ribose pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YFFH, B2467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37128 (Start-192)
      • modified residue (121)
      • modified residue (167)
      • modified residue (191)
    Domains in SCOPe 2.07: d1viub_
  • Chain 'C':
    Compound: ADP-ribose pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YFFH, B2467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37128
      • modified residue (121)
      • modified residue (167)
      • modified residue (191)
    Domains in SCOPe 2.07: d1viuc_
  • Chain 'D':
    Compound: ADP-ribose pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: YFFH, B2467
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37128
      • modified residue (121)
      • modified residue (167)
      • modified residue (191)
    Domains in SCOPe 2.07: d1viud_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1viuA (A:)
    msltqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkk
    tvvlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfel
    ymspggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktv
    lllnylqtshlmdeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viuA (A:)
    qqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvvl
    irqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymsp
    ggvtelihffiaeysdnqredievlelpfsqalemiktgeirdgktvlllnylqtshlmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1viuB (B:)
    msltqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkk
    tvvlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfel
    ymspggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktv
    lllnylqtshlmdeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viuB (B:)
    qqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvvl
    irqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymsp
    ggvtelihffiaeysdnqraedievlelpfsqalemiktgeirdgktvlllnylqtshlm
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1viuC (C:)
    msltqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkk
    tvvlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfel
    ymspggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktv
    lllnylqtshlmdeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viuC (C:)
    qitlikdkilsdnyftlhnitydltgevirhkrevydrgngatillyntkkktvvlirqf
    rvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymspggvt
    elihffiaeysdnqredievlelpfsqalemiktgeirdgktvlllnylqtshlm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1viuD (D:)
    msltqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkk
    tvvlirqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfel
    ymspggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktv
    lllnylqtshlmdeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1viuD (D:)
    qqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvvl
    irqfrvatwvngnesgqliescaglldndepevcirkeaieetgyevgevrklfelymsp
    ggvtelihffiaeysdnqradievlelpfsqalemiktgeirdgktvlllnylqtshlm