PDB entry 1vit

View 1vit on RCSB PDB site
Description: thrombin:hirudin 51-65 complex
Deposited on 1996-01-31, released 1997-04-21
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.192
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Domains in SCOP 1.55: d1vit.2
  • Chain 'G':
    Domains in SCOP 1.55: d1vit.2
  • Chain 'H':
    Domains in SCOP 1.55: d1vit.1
  • Chain 'L':
    Domains in SCOP 1.55: d1vit.1
  • Chain 'M':
    Domains in SCOP 1.55: d1vit.2

PDB Chain Sequences:

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitF (F:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwtt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitG (G:)
    svaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfv
    mkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitL (L:)
    tfgageadcglrplfekkqvqdqtekelfesyiegr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitM (M:)
    tfgageadcglrplfekkqvqdqtekelfesyiegr