PDB entry 1vit

View 1vit on RCSB PDB site
Description: thrombin:hirudin 51-65 complex
Class: complex (serine protease/inhibitor)
Keywords: COMPLEX (SERINE PROTEASE-INHIBITOR), HYDROLASE, SERINE PROTEASE, BLOOD COAGULATION, COMPLEX (SERINE PROTEASE-INHIBITOR) complex
Deposited on 1996-01-31, released 1997-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.192
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vit.2
  • Chain 'G':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vit.2
  • Chain 'H':
    Compound: alpha thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vit.1
  • Chain 'I':
    Compound: hirudin
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: hirudin
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vit.1
  • Chain 'M':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vit.2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitF (F:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwtt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitG (G:)
    svaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfv
    mkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vitH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1vitL (L:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vitL (L:)
    tfgageadcglrplfekkqvqdqtekelfesyiegr
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1vitM (M:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vitM (M:)
    tfgageadcglrplfekkqvqdqtekelfesyiegr