PDB entry 1vir

View 1vir on RCSB PDB site
Description: influenza virus hemagglutinin complexed with a neutralizing antibody
Deposited on 1995-09-13, released 1996-01-29
The last revision was dated 1996-01-29, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.169
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 1VIR (0-End)
  • Chain 'B':
    Compound: immunoglobulin
    Species: Mus musculus
  • Chain 'C':
    Compound: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-266)
      • engineered (38)
      • engineered (122)
      • engineered (242)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1virA (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1virB (B:)
    qvqlkesgpglvapsqslsitctvsgfllisngvhwvrqppgkglewlgviwaggntnyn
    salmsrvsiskdnsksqvflkmkslqtddtamyycardfydydvfyyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1virC (C:)
    vqssstgkicnnphrildgidctlidallgdphcdvfqdetwdlfverskafsncypydv
    pdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstyp
    vldvtmpnndnfdklyiwgihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
    vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
    tpdgsipndkpfqnvnkitygacpkyv