PDB entry 1vip

View 1vip on RCSB PDB site
Description: anticoagulant class II phospholipase a2 from the venom of vipera russelli russelli
Class: hydrolase
Keywords: hydrolase, phospholipase a2, anticoagulant
Deposited on 1997-02-27, released 1997-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Daboia russellii russellii [TaxId:31159]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81458 (0-120)
  Domains in SCOPe 2.06: d1vipa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vipA (A:)
  nlfqfaemivkmtgknplssysdygcycgwggkgkpqdatdrccfvhdccyekvksckpk
  lslysysfqnggivcgdnhsckravcecdrvaatcfrdnlntydkkyhnyppsqctgteq
  c