PDB entry 1vip

View 1vip on RCSB PDB site
Description: anticoagulant class ii phospholipase a2 from the venom of vipera russelli russelli
Deposited on 1997-02-27, released 1997-06-16
The last revision prior to the SCOP 1.69 freeze date was dated 1997-06-16, with a file datestamp of 1997-06-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1vip__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vip_ (-)
  nlfqfaemivkmtgknplssysdygcycgwggkgkpqdatdrccfvhdccyekvksckpk
  lslysysfqnggivcgdnhsckravcecdrvaatcfrdnlntydkkyhnyppsqctgteq
  c