PDB entry 1vin

View 1vin on RCSB PDB site
Description: bovine cyclin a3
Deposited on 1996-03-15, released 1996-08-17
The last revision prior to the SCOP 1.59 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vin_ (-)
    dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
    rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
    vlafdlaaptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaaf
    hlalytvtgqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhg
    vsllnppetlnl