PDB entry 1vim

View 1vim on RCSB PDB site
Description: Crystal structure of an hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.17
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AF1796
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1796
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28478 (14-195)
      • cloning artifact (7-13)
      • variant (94)
      • cloning artifact (196-198)
    Domains in SCOPe 2.06: d1vima1, d1vima2, d1vima3
  • Chain 'B':
    Compound: Hypothetical protein AF1796
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1796
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28478 (14-195)
      • cloning artifact (10-13)
      • variant (94)
      • cloning artifact (196-197)
    Domains in SCOPe 2.06: d1vimb1, d1vimb2, d1vimb3
  • Chain 'C':
    Compound: Hypothetical protein AF1796
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1796
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28478 (14-195)
      • cloning artifact (8-13)
      • variant (94)
      • cloning artifact (196-197)
    Domains in SCOPe 2.06: d1vimc1, d1vimc2, d1vimc3
  • Chain 'D':
    Compound: Hypothetical protein AF1796
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF1796
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28478 (14-195)
      • cloning artifact (8-13)
      • variant (94)
      • cloning artifact (196-197)
    Domains in SCOPe 2.06: d1vimd1, d1vimd2, d1vimd3
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vimA (A:)
    mghhhhhhgghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgy
    iakafamrlmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklv
    avtgkrdsslakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmq
    khltekdlearhavleeggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vimA (A:)
    hgghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafam
    rlmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrd
    sslakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekd
    learhavleegg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vimB (B:)
    mghhhhhhgghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgy
    iakafamrlmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklv
    avtgkrdsslakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmq
    khltekdlearhavleeggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vimB (B:)
    hmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamrlm
    hlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrdssl
    akmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdlea
    rhavleeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vimC (C:)
    mghhhhhhgghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgy
    iakafamrlmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklv
    avtgkrdsslakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmq
    khltekdlearhavleeggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vimC (C:)
    gghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamr
    lmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrds
    slakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdl
    earhavleeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vimD (D:)
    mghhhhhhgghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgy
    iakafamrlmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklv
    avtgkrdsslakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmq
    khltekdlearhavleeggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vimD (D:)
    gghmsllrflevvsehiknlrnhidletvgemiklidsarsifvigagrsgyiakafamr
    lmhlgytvyvvgetvtpritdqdvlvgisgsgettsvvniskkakdigsklvavtgkrds
    slakmadvvmvvkgkmkqerdeilsqlaplgtmfeltamifldalvaeimmqkhltekdl
    earhavleeg