PDB entry 1vil

View 1vil on RCSB PDB site
Description: solution structure of villin 14t, a domain conserved among actin-severing proteins
Deposited on 1993-10-20, released 1994-01-31
The last revision was dated 1994-01-31, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1vil_ (-)
    velskkvtgkldkttpgiqiwrienmemvpvptksygnfyegdcyvllstrktgsgfsyn
    ihywlgknssqdeqgaaaiyttqmdeylgsvavqhrevqghesetfrayfkqgliykqgg
    vasgmk
    

  • Chain 'p':
    No sequence available.