PDB entry 1vih

View 1vih on RCSB PDB site
Description: nmr study of vigilin, repeat 6, minimized average structure
Class: ribonucleoprotein
Keywords: RNA-binding protein, ribonucleoprotein
Deposited on 1995-11-29, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vigilin
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN VIGILIN SIXTH KH REPEAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1viha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vihA (A:)
    inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
    qakrellelas