PDB entry 1vig

View 1vig on RCSB PDB site
Description: nmr study of vigilin, repeat 6, 40 structures
Deposited on 1995-11-29, released 1996-04-03
The last revision prior to the SCOP 1.69 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d1vig__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vig_ (-)
  inrmdyveinidhkfhrhligksganinrikdqykvsvrippdseksnliriegdpqgvq
  qakrellelas