PDB entry 1vie

View 1vie on RCSB PDB site
Description: structure of dihydrofolate reductase
Deposited on 1996-10-03, released 1997-10-22
The last revision prior to the SCOP 1.71 freeze date was dated 1997-10-22, with a file datestamp of 1997-10-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1vie__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1vie_ (-)
vfpsnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaaler
in

    Sequence, based on observed residues (ATOM records): (download) 
    >1vie_ (-)
psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin