PDB entry 1vie

View 1vie on RCSB PDB site
Description: structure of dihydrofolate reductase
Deposited on 1996-10-03, released 1997-10-22
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-22, with a file datestamp of 1997-10-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1vie__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vie_ (-)
    psnatfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvqiypvaalerin