PDB entry 1vid

View 1vid on RCSB PDB site
Description: catechol o-methyltransferase
Class: transferase (methyltransferase)
Keywords: transferase, methyltransferase, neurotransmitter degradation, transferase (methyltransferase)
Deposited on 1996-01-05, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vida_
  • Heterogens: MG, SAM, DNC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vidA (A:)
    mgdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireysps
    lvlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasq
    dlipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfl
    ayvrgsssfecthyssyleymkvvdglekaiyqgpsspdks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vidA (A:)
    tkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslvl
    elgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdli
    pqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflayv
    rgsssfecthyssyleymkvvdglekaiyqgps