PDB entry 1vic

View 1vic on RCSB PDB site
Description: Crystal structure of CMP-KDO synthetase
Class: transferase
Keywords: structural genomics, Transferase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSB, HI0058
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44490 (1-253)
      • cloning artifact (254-255)
    Domains in SCOPe 2.07: d1vica1, d1vica2
  • Chain 'B':
    Compound: 3-deoxy-manno-octulosonate cytidylyltransferase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: KDSB, HI0058
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vicb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vicA (A:)
    msftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaks
    fgaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfn
    vnmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsd
    aylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdt
    aedlekvrailaangshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vicA (A:)
    sftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaksf
    gaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfnv
    nmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsda
    ylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdta
    edlekvrailaangs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vicB (B:)
    msftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaks
    fgaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfn
    vnmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnlqdvqkvqlsd
    aylrhigiyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdt
    aedlekvrailaangshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vicB (B:)
    sftviiparfassrlpgkpladikgkpmiqhvfekalqsgasrviiatdnenvadvaksf
    gaevcmtsvnhnsgterlaevveklaipdneiivniqgdeplippvivrqvadnlakfnv
    nmaslavkihdaeelfnpnavkvltdkdgyvlyfsrsvipydrdqfmnkvqlsdaylrhi
    giyayragfikqyvqwaptqlenlekleqlrvlyngerihvelakevpavgvdtaedlek
    vrailaan