PDB entry 1vib

View 1vib on RCSB PDB site
Description: nmr solution structure of the neurotoxin b-IV, 20 structures
Class: neurotoxin
Keywords: neurotoxin, toxin, hydroxylation
Deposited on 1996-11-25, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurotoxin b-IV
    Species: CEREBRATULUS LACTEUS [TaxId:6221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01525 (0-54)
      • conflict (9)
    Domains in SCOPe 2.07: d1viba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vibA (A:)
    asatwgaaypacenncrkkydlcircqgkwagkrgkcaahciiqknnckgkckke