PDB entry 1vi9

View 1vi9 on RCSB PDB site
Description: Crystal structure of pyridoxamine kinase
Class: transferase
Keywords: structural genomics, Transferase
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxamine kinase
    Species: Escherichia coli [TaxId:562]
    Gene: PDXY, B1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77150 (3-288)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (27)
      • modified residue (54)
      • modified residue (56)
      • modified residue (116)
      • modified residue (197)
      • modified residue (217)
      • modified residue (256)
      • modified residue (262)
      • cloning artifact (289)
    Domains in SCOPe 2.08: d1vi9a1, d1vi9a2, d1vi9a3
  • Chain 'B':
    Compound: Pyridoxamine kinase
    Species: Escherichia coli [TaxId:562]
    Gene: PDXY, B1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77150 (3-288)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (27)
      • modified residue (54)
      • modified residue (56)
      • modified residue (116)
      • modified residue (197)
      • modified residue (217)
      • modified residue (256)
      • modified residue (262)
      • cloning artifact (289)
    Domains in SCOPe 2.08: d1vi9b1, d1vi9b2, d1vi9b3
  • Chain 'C':
    Compound: Pyridoxamine kinase
    Species: Escherichia coli [TaxId:562]
    Gene: PDXY, B1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77150 (3-288)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (27)
      • modified residue (54)
      • modified residue (56)
      • modified residue (116)
      • modified residue (197)
      • modified residue (217)
      • modified residue (256)
      • modified residue (262)
      • cloning artifact (289)
    Domains in SCOPe 2.08: d1vi9c1, d1vi9c2, d1vi9c3
  • Chain 'D':
    Compound: Pyridoxamine kinase
    Species: Escherichia coli [TaxId:562]
    Gene: PDXY, B1636
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77150 (3-288)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (27)
      • modified residue (54)
      • modified residue (56)
      • modified residue (116)
      • modified residue (197)
      • modified residue (217)
      • modified residue (256)
      • modified residue (262)
      • cloning artifact (289)
    Domains in SCOPe 2.08: d1vi9d1, d1vi9d2, d1vi9d3
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi9A (A:)
    mslmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmpps
    hlteivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghp
    ekgcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqi
    vlvkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqga
    tlqealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi9A (A:)
    lmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
    teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
    gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
    vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
    qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi9B (B:)
    mslmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmpps
    hlteivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghp
    ekgcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqi
    vlvkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqga
    tlqealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi9B (B:)
    lmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
    teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
    gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
    vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
    qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vi9C (C:)
    mslmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmpps
    hlteivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghp
    ekgcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqi
    vlvkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqga
    tlqealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi9C (C:)
    lmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
    teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
    gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
    vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
    qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vi9D (D:)
    mslmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmpps
    hlteivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghp
    ekgcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqi
    vlvkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqga
    tlqealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi9D (D:)
    lmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
    teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
    gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
    vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
    qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkle