PDB entry 1vi8

View 1vi8 on RCSB PDB site
Description: Crystal structure of a putative thioesterase
Class: Structural genomics, unknown function
Keywords: PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.241
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vi8a1, d1vi8a2, d1vi8a3
  • Chain 'B':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138-146)
    Domains in SCOPe 2.07: d1vi8b1, d1vi8b2, d1vi8b3
  • Chain 'C':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vi8c1, d1vi8c2, d1vi8c3
  • Chain 'D':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vi8d1, d1vi8d2, d1vi8d3
  • Chain 'E':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vi8e1, d1vi8e2, d1vi8e3
  • Chain 'F':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vi8f1, d1vi8f2, d1vi8f3
  • Chain 'G':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vi8g1, d1vi8g2, d1vi8g3
  • Chain 'H':
    Compound: Hypothetical protein ydiI
    Species: Escherichia coli [TaxId:562]
    Gene: YDII, B1686
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77781 (3-137)
      • cloning artifact (1-2)
      • cloning artifact (138)
    Domains in SCOPe 2.07: d1vi8h1, d1vi8h2, d1vi8h3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi8A (A:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8A (A:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi8B (B:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8B (B:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaileggshhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vi8C (C:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8C (C:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vi8D (D:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8D (D:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vi8E (E:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8E (E:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vi8F (F:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8F (F:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vi8G (G:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8G (G:)
    liwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasvv
    laesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieifd
    ekgrlccssrlttaile
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vi8H (H:)
    msliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggas
    vvlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqiei
    fdekgrlccssrlttaileggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi8H (H:)
    sliwkrkitlealnamgegnmvgfldirfehigddtleatmpvdsrtkqpfgllhggasv
    vlaesigsvagylctegeqkvvgleinanhvrsaregrvrgvckplhlgsrhqvwqieif
    dekgrlccssrlttaile