PDB entry 1vi7

View 1vi7 on RCSB PDB site
Description: Crystal structure of an hypothetical protein
Class: Structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yigZ
    Species: Escherichia coli [TaxId:562]
    Gene: YIGZ, B3848
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27862 (3-206)
      • cloning artifact (2)
      • cloning artifact (207)
    Domains in SCOPe 2.07: d1vi7a1, d1vi7a2, d1vi7a3, d1vi7a4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi7A (A:)
    mslmeswlipaapvtvveeikksrfitmlahtdgveaakafvesvraehpdarhhcvawv
    agapddsqqlgfsddgepagtagkpmlaqlmgsgvgeitavvvryyggillgtgglvkay
    gggvnqalrqlttqrktplteytlqceyhqltgieallgqcdgkiinsdyqafvllrval
    paakvaefsakladfsrgslqllaieeeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi7A (A:)
    lmeswlipaapvtvveeikksrfitmlahtdgveaakafvesvraehpdarhhcvawvag
    apddsqqlgfsddgepagtagkpmlaqlmgsgvgeitavvvryyggillgtgglvkaygg
    gvnqalrqlttqrktplteytlqceyhqltgieallgqcdgkiinsdyqafvllrvalpa
    akvaefsakladfsrgslqllaieee