PDB entry 1vi6

View 1vi6 on RCSB PDB site
Description: Crystal structure of ribosomal protein S2P
Class: ribosome
Keywords: structural genomics, RIBOSOME
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.208
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vi6a_
  • Chain 'B':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vi6b_
  • Chain 'C':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29132 (Start-197)
      • cloning artifact (198)
    Domains in SCOPe 2.05: d1vi6c_
  • Chain 'D':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1vi6d_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi6A (A:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi6A (A:)
    eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
    yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
    idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
    dftysiedfeael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi6B (B:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi6B (B:)
    eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
    yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
    idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
    dftysiedfeael
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vi6C (C:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi6C (C:)
    eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
    yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
    idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
    dftysiedfeaele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vi6D (D:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi6D (D:)
    eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
    yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
    idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
    dftysiedfeael