PDB entry 1vi5

View 1vi5 on RCSB PDB site
Description: crystal structure of ribosomal protein s2p
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-30, with a file datestamp of 2003-12-30.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.246
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vi5a_
  • Chain 'B':
    Domains in SCOP 1.67: d1vi5b_
  • Chain 'C':
    Domains in SCOP 1.67: d1vi5c_
  • Chain 'D':
    Domains in SCOP 1.67: d1vi5d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi5A (A:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5A (A:)
    eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
    yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
    idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
    dftysiedfeaeleggsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi5B (B:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5B (B:)
    keyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakfls
    ryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndp
    aidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirg
    qdftysiedfeaele
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vi5C (C:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5C (C:)
    yeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsry
    epskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpai
    dkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgqd
    ftysiedfeaele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vi5D (D:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5D (D:)
    yeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsry
    epskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpai
    dkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgqd
    ftysiedfeael