PDB entry 1vi5

View 1vi5 on RCSB PDB site
Description: Crystal structure of ribosomal protein S2P
Class: ribosome
Keywords: structural genomics, RIBOSOME
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29132 (Start-197)
      • modified residue (31)
      • modified residue (85)
      • modified residue (108)
      • cloning artifact (198-202)
    Domains in SCOPe 2.07: d1vi5a1, d1vi5a2
  • Chain 'B':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29132 (Start-197)
      • modified residue (31)
      • modified residue (85)
      • modified residue (108)
      • cloning artifact (198)
    Domains in SCOPe 2.07: d1vi5b1, d1vi5b2
  • Chain 'C':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29132 (Start-197)
      • modified residue (31)
      • modified residue (85)
      • modified residue (108)
      • cloning artifact (198)
    Domains in SCOPe 2.07: d1vi5c1, d1vi5c2
  • Chain 'D':
    Compound: 30S ribosomal protein S2P
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: RPS2P, AF1133
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29132 (Start-197)
      • modified residue (31)
      • modified residue (85)
      • modified residue (108)
    Domains in SCOPe 2.07: d1vi5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vi5A (A:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5A (A:)
    eyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsr
    yepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpa
    idkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgq
    dftysiedfeaeleggsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vi5B (B:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5B (B:)
    keyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakfls
    ryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndp
    aidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirg
    qdftysiedfeaele
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vi5C (C:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5C (C:)
    yeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsry
    epskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpai
    dkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgqd
    ftysiedfeaele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vi5D (D:)
    mslekeyeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaa
    kflsryepskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvf
    vndpaidkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareia
    kirgqdftysiedfeaeleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vi5D (D:)
    yeylvppddylaagvhigtqiktgdmkkfifkvrqdglyvldirklderirvaakflsry
    epskillvaarqyahkpvqmfskvvgsdyivgrfipgtltnpmlseyrepevvfvndpai
    dkqavseatavgipvvalcdsnnssadvdlviptnnkgrralaivywllareiakirgqd
    ftysiedfeael